PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_007538-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 213aa    MW: 24136.6 Da    PI: 4.7106
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_007538-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-201669356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     +R +f+++q++ +e++F++++ p  ++++++A++lgL  rqV+vWFqN+Ra+ k
  AHYPO_007538-RA 16 NRKRFSSQQVKSMESMFNSESRPGSKTKQQIADELGLHPRQVSVWFQNKRARSK 69
                     5999************************************************99 PP

2HD-ZIP_I/II108.83.8e-3517107393
      HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ++r+s++qvk++E++F++e++  ++ K+++a eLgl+prqv vWFqn+RAR k+kq+E+dy+ Lk++yd+l+++ e+Leke+++L  e+++
  AHYPO_007538-RA  17 RKRFSSQQVKSMESMFNSESRPGSKTKQQIADELGLHPRQVSVWFQNKRARSKSKQTERDYNILKACYDSLASKYEALEKENQHLIVEVQR 107
                      89***********************************************************************************988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-17673IPR009057Homeodomain-like
PROSITE profilePS5007117.1191171IPR001356Homeobox domain
SMARTSM003891.7E-171375IPR001356Homeobox domain
PfamPF000467.1E-181669IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.4E-191778IPR009057Homeodomain-like
CDDcd000862.13E-151772No hitNo description
PRINTSPR000313.5E-54251IPR000047Helix-turn-helix motif
PROSITE patternPS0002704669IPR017970Homeobox, conserved site
PRINTSPR000313.5E-55167IPR000047Helix-turn-helix motif
PfamPF021835.4E-1871112IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MDTNPASSMQ TDKSINRKRF SSQQVKSMES MFNSESRPGS KTKQQIADEL GLHPRQVSVW  60
FQNKRARSKS KQTERDYNIL KACYDSLASK YEALEKENQH LIVEVQRLRG LTERPKDSTS  120
DTTPATCSSN GDSISLSSAE KHIAQPEDYV QDKIMCEAVF EGFTNTEEET DNHENIDMTE  180
MGDGSLTSSY SILEPTYLIE HNSGLDLWEF WT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010676907.12e-88PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLA0A0K9RNE31e-103A0A0K9RNE3_SPIOL; Uncharacterized protein
STRINGVIT_02s0025g02590.t012e-39(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-35homeobox 7